| Catalog number | 33R-10359 |
|---|---|
| Name | Ccl11 Blocking Peptide |
| Size | 100 ug |
| Price | 280.00 EUR |
| Supplier | fitzgerald |
| Order | |
| Extended details | |
| Product Type | Proteins |
| Product Subtype | Blocking Peptides |
| Research Area | Cell Biology |
| Tag/Conjugate | LKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTP |
| Type1 | Synthetic |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
| Applications | WB, IHC |
| Shipping Info | Blue Ice |
| Test | You can block the antibody by the specific target amino acid sequence of peptide. |
| Properties | blocking peptide |
| Description | Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. |