InformationCatalog number | C114-10 |
---|
Name | Recombinant Human C-C Motif Chemokine 26/CCL26 (27-94) |
---|
Size | 10 ug |
---|
Price | 180.00 EUR |
---|
Supplier | novo |
---|
Order |
|
Description | Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Ser27-Leu94 is expressed. |
---|
Species reactivity | Human |
---|
Origin | Escherichia coli |
---|
Peptide sequence | MSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
---|
Estimated molecular weight | 8,21 kDa |
---|
Protein purity | Greater than 95% as determined by reducing SDS-PAGE. |
---|
Endotoxin level | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
---|
Shipping condition | Ambient/Room Temperature |
---|
Package form | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
---|
Storage conditions | Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months. |
---|
Reconstitution conditions | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
---|
UniProt number | Q9Y258 |
---|
Additional description | Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1. |
---|
Properties | Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples. |
---|
Source | Recombinants or rec. proteins |
---|
Group | recombinants |
---|