Information
| Catalog number |
C696-1000 |
| Name |
Recombinant Mouse C-C Motif Chemokine 24/CCL24/Eotaxin-2 |
| Size |
1 mg |
| Price |
2283.00 EUR |
| Supplier |
novo
|
|
Order
|
| Description |
Recombinant Mouse C-C Motif Chemokine 24 is produced by our E.coli expression system and the target gene encoding Val27-Val119 is expressed. |
| Species reactivity |
Mouse |
| Origin |
Escherichia coli |
| Peptide sequence |
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV |
| Estimated molecular weight |
10,3 kDa |
| Protein purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin level |
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Shipping condition |
Ambient/Room Temperature |
| Package form |
Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage conditions |
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months. |
| Reconstitution conditions |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| UniProt number |
Q9JKC0 |
| Additional description |
Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1. |
| Test |
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain. |
| Latin name |
Mus musculus |
| Source |
Recombinants or rec. proteins |
| Group |
recombinants |