Catalog number | C113-10 |
---|---|
Name | Recombinant Human C-C Motif Chemokine 26/CCL26 (24-94) |
Size | 10 ug |
Price | 169.00 EUR |
Supplier | novo |
Order | |
Extended details | |
Description | Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Thr24-Leu94 is expressed. |
Species reactivity | Human |
Origin | Escherichia coli |
Peptide sequence | MTRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
Estimated molecular weight | 8,53 kDa |
Protein purity | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin level | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Shipping condition | Dry ice/ice packs |
Package form | Supplied as a 0.2 µm filtered solution of 20mM Tris, 1mM EDTA, 20% Glycerol, pH 9.0. |
Storage conditions | Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Reconstitution conditions | See included datasheet or contact us for more information. |
UniProt number | Q9Y258 |
Additional description | Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1. |
Properties | Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples. |
Source | Recombinants or rec. proteins |
Group | recombinants |