Recombinant Human C-C Motif Chemokine 26/CCL26 (24-94)

Information
Catalog number C113-1000
Name Recombinant Human C-C Motif Chemokine 26/CCL26 (24-94)
Size 1 mg
Price 1837.00 EUR
Supplier novo
Order
Extended details
Description Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Thr24-Leu94 is expressed.
Species reactivity Human
Origin Escherichia coli
Peptide sequence MTRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Estimated molecular weight 8,53 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Dry ice/ice packs
Package form Supplied as a 0.2 µm filtered solution of 20mM Tris, 1mM EDTA, 20% Glycerol, pH 9.0.
Storage conditions Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number Q9Y258
Additional description Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants